SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5gzna1 (5gzn A:1-303)

  1. Root: SCOPe 2.06
  2. 2223823Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2225037Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily)
    2 intertwined domains; all-beta and alpha+beta
  4. 2225038Superfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (2 families) (S)
  5. 2225083Family f.10.1.0: automated matches [227258] (1 protein)
    not a true family
  6. 2225084Protein automated matches [227047] (6 species)
    not a true protein
  7. 2273977Species Zika virus [TaxId:64320] [317278] (5 PDB entries)
  8. 2284356Domain d5gzna1: 5gzn A:1-303 [327657]
    Other proteins in same PDB: d5gzna2, d5gznb2, d5gznd1, d5gznd2, d5gznl1, d5gznl2
    automated match to d4gsxa1

Details for d5gzna1

PDB Entry: 5gzn (more details), 3 Å

PDB Description: structure of neutralizing antibody bound to zika envelope protein
PDB Compounds: (A:) Genome polyprotein

SCOPe Domain Sequences for d5gzna1:

Sequence, based on SEQRES records: (download)

>d5gzna1 f.10.1.0 (A:1-303) automated matches {Zika virus [TaxId: 64320]}
ircigvsnrdfvegmsggtwvdvvlehggcvtvmaqdkptvdielvtttvsnmaevrsyc
yeasisdmasdsrcptqgeayldkqsdtqyvckrtlvdrgwgngcglfgkgslvtcakfa
cskkmtgksiqpenleyrimlsvhgsqhsgmivndtghetdenrakveitpnspraeatl
ggfgslgldceprtgldfsdlyyltmnnkhwlvhkewfhdiplpwhagadtgtphwnnke
alvefkdahakrqtvvvlgsqegavhtalagaleaemdgakgrlssghlkcrlkmdklrl
kgv

Sequence, based on observed residues (ATOM records): (download)

>d5gzna1 f.10.1.0 (A:1-303) automated matches {Zika virus [TaxId: 64320]}
ircigvsnrdfvegmsggtwvdvvlehggcvtvmaqdkptvdielvtttvsnmaevrsyc
yeasisdmasdsrcptqgeayldkqsdtqyvckrtlvdrgwgngcglfgkgslvtcakfa
cskkmtgksiqpenleyrimlsvhgsqhndtghetdenrakveitpnspraeatlggfgs
lgldceprtgldfsdlyyltmnnkhwlvhkewfhdiplpwhagadtgtphwnnkealvef
kdahakrqtvvvlgsqegavhtalagaleaemdgakgrlssghlkcrlkmdklrlkgv

SCOPe Domain Coordinates for d5gzna1:

Click to download the PDB-style file with coordinates for d5gzna1.
(The format of our PDB-style files is described here.)

Timeline for d5gzna1:

  • d5gzna1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-29