Lineage for d5gzna1 (5gzn A:1-303)

  1. Root: SCOPe 2.06
  2. 2223823Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2225037Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily)
    2 intertwined domains; all-beta and alpha+beta
  4. 2225038Superfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (2 families) (S)
  5. 2225083Family f.10.1.0: automated matches [227258] (1 protein)
    not a true family
  6. 2225084Protein automated matches [227047] (6 species)
    not a true protein
  7. 2273977Species Zika virus [TaxId:64320] [317278] (5 PDB entries)
  8. 2284356Domain d5gzna1: 5gzn A:1-303 [327657]
    Other proteins in same PDB: d5gzna2, d5gznb2, d5gznd1, d5gznd2, d5gznl1, d5gznl2
    automated match to d4gsxa1

Details for d5gzna1

PDB Entry: 5gzn (more details), 3 Å

PDB Description: structure of neutralizing antibody bound to zika envelope protein
PDB Compounds: (A:) Genome polyprotein

SCOPe Domain Sequences for d5gzna1:

Sequence, based on SEQRES records: (download)

>d5gzna1 f.10.1.0 (A:1-303) automated matches {Zika virus [TaxId: 64320]}
ircigvsnrdfvegmsggtwvdvvlehggcvtvmaqdkptvdielvtttvsnmaevrsyc
yeasisdmasdsrcptqgeayldkqsdtqyvckrtlvdrgwgngcglfgkgslvtcakfa
cskkmtgksiqpenleyrimlsvhgsqhsgmivndtghetdenrakveitpnspraeatl
ggfgslgldceprtgldfsdlyyltmnnkhwlvhkewfhdiplpwhagadtgtphwnnke
alvefkdahakrqtvvvlgsqegavhtalagaleaemdgakgrlssghlkcrlkmdklrl
kgv

Sequence, based on observed residues (ATOM records): (download)

>d5gzna1 f.10.1.0 (A:1-303) automated matches {Zika virus [TaxId: 64320]}
ircigvsnrdfvegmsggtwvdvvlehggcvtvmaqdkptvdielvtttvsnmaevrsyc
yeasisdmasdsrcptqgeayldkqsdtqyvckrtlvdrgwgngcglfgkgslvtcakfa
cskkmtgksiqpenleyrimlsvhgsqhndtghetdenrakveitpnspraeatlggfgs
lgldceprtgldfsdlyyltmnnkhwlvhkewfhdiplpwhagadtgtphwnnkealvef
kdahakrqtvvvlgsqegavhtalagaleaemdgakgrlssghlkcrlkmdklrlkgv

SCOPe Domain Coordinates for d5gzna1:

Click to download the PDB-style file with coordinates for d5gzna1.
(The format of our PDB-style files is described here.)

Timeline for d5gzna1:

  • d5gzna1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-29