Lineage for d5lxea_ (5lxe A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2089162Superfamily c.1.16: Bacterial luciferase-like [51679] (5 families) (S)
    consists of clearly related families of somewhat different folds
  5. 2089216Family c.1.16.0: automated matches [191510] (1 protein)
    not a true family
  6. 2089217Protein automated matches [190849] (8 species)
    not a true protein
  7. 2284351Species Rhodococcus jostii [TaxId:101510] [327652] (1 PDB entry)
  8. 2284352Domain d5lxea_: 5lxe A: [327653]
    automated match to d1rhca_
    complexed with gol, so4

Details for d5lxea_

PDB Entry: 5lxe (more details), 1.47 Å

PDB Description: f420-dependent glucose-6-phosphate dehydrogenase from rhodococcus jostii rha1
PDB Compounds: (A:) F420-dependent glucose-6-phosphate dehydrogenase 1

SCOPe Domain Sequences for d5lxea_:

Sequence, based on SEQRES records: (download)

>d5lxea_ c.1.16.0 (A:) automated matches {Rhodococcus jostii [TaxId: 101510]}
mvikfgykasaeqfgprelvelgvlaeahgmdsatvsdhfqpwrhegghapfslawmtav
gertsrlqlgtsvmtptfrynpavvaqafatmgclypgrimlgvgtgealneiatgfage
wpefkerfarlreavalmrelwlgdrvdfegnyyktvgasiydvpeggipvyiaaggpvv
aryagrsgdgfictsgkgmelyteklmpavaegaekadrdvaeidkmieikisydtdpel
alentrfwaplsltpeqkhsiddpiemeraadalpieqvakrwivasdpdeavaqirpyl
daglnhlvfhapghdqkrflelfqrdlaprlrgl

Sequence, based on observed residues (ATOM records): (download)

>d5lxea_ c.1.16.0 (A:) automated matches {Rhodococcus jostii [TaxId: 101510]}
mvikfgykasaeqfgprelvelgvlaeahgmdsatvsdhfqpwrhegghapfslawmtav
gertsrlqlgtsvmtptfrynpavvaqafatmgclypgrimlgvgtgealneiatgfage
wpefkerfarlreavalmrelwlgdrvdfegnyyktvgasiydvpeggipvyiaaggpvv
aryagrsgdgfictsgkgmelyteklmpavaegaekadrdvaeidkmieikisydtdpel
alentrfwaplslpiemeraadalpieqvakrwivasdpdeavaqirpyldaglnhlvfh
apghdqkrflelfqrdlaprlrgl

SCOPe Domain Coordinates for d5lxea_:

Click to download the PDB-style file with coordinates for d5lxea_.
(The format of our PDB-style files is described here.)

Timeline for d5lxea_:

  • d5lxea_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-29