SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5lxea_ (5lxe A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2089162Superfamily c.1.16: Bacterial luciferase-like [51679] (5 families) (S)
    consists of clearly related families of somewhat different folds
  5. 2089216Family c.1.16.0: automated matches [191510] (1 protein)
    not a true family
  6. 2089217Protein automated matches [190849] (7 species)
    not a true protein
  7. 2284351Species Rhodococcus jostii [TaxId:101510] [327652] (1 PDB entry)
  8. 2284352Domain d5lxea_: 5lxe A: [327653]
    automated match to d1rhca_
    complexed with gol, so4

Details for d5lxea_

PDB Entry: 5lxe (more details), 1.47 Å

PDB Description: f420-dependent glucose-6-phosphate dehydrogenase from rhodococcus jostii rha1
PDB Compounds: (A:) F420-dependent glucose-6-phosphate dehydrogenase 1

SCOPe Domain Sequences for d5lxea_:

Sequence, based on SEQRES records: (download)

>d5lxea_ c.1.16.0 (A:) automated matches {Rhodococcus jostii [TaxId: 101510]}
mvikfgykasaeqfgprelvelgvlaeahgmdsatvsdhfqpwrhegghapfslawmtav
gertsrlqlgtsvmtptfrynpavvaqafatmgclypgrimlgvgtgealneiatgfage
wpefkerfarlreavalmrelwlgdrvdfegnyyktvgasiydvpeggipvyiaaggpvv
aryagrsgdgfictsgkgmelyteklmpavaegaekadrdvaeidkmieikisydtdpel
alentrfwaplsltpeqkhsiddpiemeraadalpieqvakrwivasdpdeavaqirpyl
daglnhlvfhapghdqkrflelfqrdlaprlrgl

Sequence, based on observed residues (ATOM records): (download)

>d5lxea_ c.1.16.0 (A:) automated matches {Rhodococcus jostii [TaxId: 101510]}
mvikfgykasaeqfgprelvelgvlaeahgmdsatvsdhfqpwrhegghapfslawmtav
gertsrlqlgtsvmtptfrynpavvaqafatmgclypgrimlgvgtgealneiatgfage
wpefkerfarlreavalmrelwlgdrvdfegnyyktvgasiydvpeggipvyiaaggpvv
aryagrsgdgfictsgkgmelyteklmpavaegaekadrdvaeidkmieikisydtdpel
alentrfwaplslpiemeraadalpieqvakrwivasdpdeavaqirpyldaglnhlvfh
apghdqkrflelfqrdlaprlrgl

SCOPe Domain Coordinates for d5lxea_:

Click to download the PDB-style file with coordinates for d5lxea_.
(The format of our PDB-style files is described here.)

Timeline for d5lxea_:

  • d5lxea_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-29