Lineage for d1egr__ (1egr -)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.47: Thioredoxin fold [52832] (3 superfamilies) Superfamily c.47.1: Thioredoxin-like [52833] (10 families) 
Family c.47.1.1: Thioltransferase [52834] (2 proteins) Protein Glutaredoxin (Thioltransferase) [52843] (5 species) 
Species Escherichia coli [TaxId:562] [52845] (4 PDB entries) 
Domain d1egr__: 1egr - [32765]
Details for d1egr__
PDB Entry: 1egr (more details)
PDB Description: sequence-specific 1h n.m.r. assignments and determination of the three-dimensional structure of reduced escherichia coli glutaredoxin
SCOP Domain Sequences for d1egr__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1egr__ c.47.1.1 (-) Glutaredoxin (Thioltransferase) {Escherichia coli}
mqtvifgrsgcpycvrakdlaeklsnerddfqyqyvdiraegitkedlqqkagkpvetvp
qifvdqqhiggytdfaawvkenlda
SCOP Domain Coordinates for d1egr__:
Click to download the PDB-style file with coordinates for d1egr__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1egr__:
- d1egr__ appears in SCOP 1.57
- d1egr__ appears in the current release, SCOPe 2.08, called d1egra_
View in 3D