SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5jyla_ (5jyl A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2030835Superfamily b.1.6: Cadherin-like [49313] (3 families) (S)
  5. 2030836Family b.1.6.1: Cadherin [49314] (4 protein domains)
  6. 2284341Protein automated matches [327642] (1 species)
    not a true protein
  7. 2284342Species Homo sapiens [TaxId:9606] [327643] (1 PDB entry)
  8. 2284343Domain d5jyla_: 5jyl A: [327644]
    Other proteins in same PDB: d5jylb1, d5jylb2, d5jyld1, d5jyld2
    automated match to d1suha_
    complexed with cl, gol, po4

Details for d5jyla_

PDB Entry: 5jyl (more details), 2.55 Å

PDB Description: human p-cadherin mec1 with scfv tsp7 bound
PDB Compounds: (A:) Cadherin-3

SCOPe Domain Sequences for d5jyla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jyla_ b.1.6.1 (A:) automated matches {Homo sapiens [TaxId: 9606]}
vapisvpengkgpfpqrlnqlksnkdrdtkifysitgpgadsppegvfaveketgwllln
kpldreeiakyelfghavsengasvedpmnisiivtd

SCOPe Domain Coordinates for d5jyla_:

Click to download the PDB-style file with coordinates for d5jyla_.
(The format of our PDB-style files is described here.)

Timeline for d5jyla_:

  • d5jyla_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-29