SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5jymd1 (5jym D:1-121)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2026644Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2026645Protein automated matches [190740] (25 species)
    not a true protein
  7. 2028399Species Mouse (Mus musculus) [TaxId:10090] [188198] (535 PDB entries)
  8. 2284335Domain d5jymd1: 5jym D:1-121 [327636]
    Other proteins in same PDB: d5jyma1, d5jyma2, d5jymc1, d5jymc2
    automated match to d1dzba1
    complexed with ca

Details for d5jymd1

PDB Entry: 5jym (more details), 2.45 Å

PDB Description: human p-cadherin ec12 with scfv tsp11 bound
PDB Compounds: (D:) Antibody scFv TSP11

SCOPe Domain Sequences for d5jymd1:

Sequence, based on SEQRES records: (download)

>d5jymd1 b.1.1.0 (D:1-121) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qvqlqqpgtelvkpgasvklsckasgytftrywinwvkqrpqgglewigniypgsnitny
nekfknkatltvdtssntaymqlssltsddsavyycaregiydgyfplfpywgqgtlvtv
s

Sequence, based on observed residues (ATOM records): (download)

>d5jymd1 b.1.1.0 (D:1-121) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qvqlqqplvkpgasvklsckasgytftrywinwvkqrpglewigniypgsnitnynekfk
nkatltvdtssntaymqlssltsddsavyycaregiydgyfplfpywgqgtlvtvs

SCOPe Domain Coordinates for d5jymd1:

Click to download the PDB-style file with coordinates for d5jymd1.
(The format of our PDB-style files is described here.)

Timeline for d5jymd1:

  • d5jymd1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-29