SCOPe 2.06: Domain d5jymb1: 5jym B:1-120

Lineage for d5jymb1 (5jym B:1-120)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (574 PDB entries)

8. Domain d5jymb1: 5jym B:1-120 [327629]
   Other proteins in same PDB: d5jyma1, d5jyma2, d5jymc1, d5jymc2
   automated match to d1dzba1
   complexed with ca

Details for d5jymb1

PDB Entry: 5jym, 2.45 Å

PDB Description: human p-cadherin ec12 with scfv tsp11 bound

PDB Compounds: (B:) Antibody scFv TSP11

SCOPe Domain Sequences for d5jymb1:

Sequence, based on SEQRES records:

>d5jymb1 b.1.1.0 (B:1-120) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qvqlqqpgtelvkpgasvklsckasgytftrywinwvkqrpqgglewigniypgsnitny
nekfknkatltvdtssntaymqlssltsddsavyycaregiydgyfplfpywgqgtlvtv

Sequence, based on observed residues (ATOM records):

>d5jymb1 b.1.1.0 (B:1-120) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qvqlqqpgtelvkpgasvklsckasgytftrywinwvkqrpglewigniypgsnitnyne
kfknkatltvdtssntaymqlssltsddsavyycaregiydgyfplfpywgqgtlvtv

Timeline for d5jymb1:

• d5jymb1 is new in SCOPe 2.06-stable
  
• d5jymb1 appears in SCOPe 2.07
  
• d5jymb1 appears in the current release, SCOPe 2.08