Lineage for d5jymb1 (5jym B:6-120)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2760735Domain d5jymb1: 5jym B:6-120 [327629]
    Other proteins in same PDB: d5jyma1, d5jyma2, d5jymb3, d5jymc1, d5jymc2, d5jymd3
    automated match to d1dzba1
    complexed with ca

Details for d5jymb1

PDB Entry: 5jym (more details), 2.45 Å

PDB Description: human p-cadherin ec12 with scfv tsp11 bound
PDB Compounds: (B:) Antibody scFv TSP11

SCOPe Domain Sequences for d5jymb1:

Sequence, based on SEQRES records: (download)

>d5jymb1 b.1.1.0 (B:6-120) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qpgtelvkpgasvklsckasgytftrywinwvkqrpqgglewigniypgsnitnynekfk
nkatltvdtssntaymqlssltsddsavyycaregiydgyfplfpywgqgtlvtv

Sequence, based on observed residues (ATOM records): (download)

>d5jymb1 b.1.1.0 (B:6-120) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qpgtelvkpgasvklsckasgytftrywinwvkqrpglewigniypgsnitnynekfknk
atltvdtssntaymqlssltsddsavyycaregiydgyfplfpywgqgtlvtv

SCOPe Domain Coordinates for d5jymb1:

Click to download the PDB-style file with coordinates for d5jymb1.
(The format of our PDB-style files is described here.)

Timeline for d5jymb1: