SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5jyma2 (5jym A:102-213)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2030835Superfamily b.1.6: Cadherin-like [49313] (3 families) (S)
  5. 2030925Family b.1.6.0: automated matches [191376] (1 protein)
    not a true family
  6. 2030926Protein automated matches [190458] (4 species)
    not a true protein
  7. 2030941Species Human (Homo sapiens) [TaxId:9606] [255601] (16 PDB entries)
  8. 2284324Domain d5jyma2: 5jym A:102-213 [327625]
    Other proteins in same PDB: d5jymb1, d5jymb2, d5jymd1, d5jymd2
    automated match to d4oy9a2
    complexed with ca

Details for d5jyma2

PDB Entry: 5jym (more details), 2.45 Å

PDB Description: human p-cadherin ec12 with scfv tsp11 bound
PDB Compounds: (A:) Cadherin-3

SCOPe Domain Sequences for d5jyma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jyma2 b.1.6.0 (A:102-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ndhkpkftqdtfrgsvlegvlpgtsvmqvtatdeddaiytyngvvaysihsqepkdphdl
mftihrstgtisvissgldrekvpeytltiqatdmdgdgstttavavveild

SCOPe Domain Coordinates for d5jyma2:

Click to download the PDB-style file with coordinates for d5jyma2.
(The format of our PDB-style files is described here.)

Timeline for d5jyma2:

  • d5jyma2 appears in periodic updates to SCOPe 2.06 starting on 2016-12-28