SCOPe 2.06: Domain d5h91a_: 5h91 A:

Lineage for d5h91a_ (5h91 A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.0: automated matches [191319] (1 protein)
   not a true family

6. Protein automated matches [190115] (75 species)
   not a true protein

7. Species Lactobacillus brevis [TaxId:1580] [327609] (1 PDB entry)

8. Domain d5h91a_: 5h91 A: [327619]
   automated match to d3ng3d_
   complexed with acy; mutant

Details for d5h91a_

PDB Entry: 5h91, 1.77 Å

PDB Description: lbdera mutant-t29l/f163y

PDB Compounds: (A:) deoxyribose-phosphate aldolase

SCOPe Domain Sequences for d5h91a_:

Sequence; same for both SEQRES and ATOM records:

>d5h91a_ c.1.10.0 (A:) automated matches {Lactobacillus brevis [TaxId: 1580]}
ltteqlakyidhtnlkadateadikqlcdeakkfntasvcvnsywipfvteqlkgtdvnp
iavvgfplgamateseifeattaidqgaeeidmvlnvgelkggndekvladiqgladavh
akgkilkvilenalltkdeivracqlsekagadfvktstgystsgakvedvklmretvgd
rlgvkasggihsreealamidagasrmgvsatvailt

Timeline for d5h91a_:

• d5h91a_ is new in SCOPe 2.06-stable
  
• d5h91a_ appears in SCOPe 2.07
  
• d5h91a_ appears in the current release, SCOPe 2.08