SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5h91a_ (5h91 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2085156Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2086456Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2086457Protein automated matches [190115] (73 species)
    not a true protein
  7. 2284308Species Lactobacillus brevis [TaxId:1580] [327609] (1 PDB entry)
  8. 2284318Domain d5h91a_: 5h91 A: [327619]
    automated match to d3ng3d_
    complexed with acy; mutant

Details for d5h91a_

PDB Entry: 5h91 (more details), 1.77 Å

PDB Description: lbdera mutant-t29l/f163y
PDB Compounds: (A:) deoxyribose-phosphate aldolase

SCOPe Domain Sequences for d5h91a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h91a_ c.1.10.0 (A:) automated matches {Lactobacillus brevis [TaxId: 1580]}
ltteqlakyidhtnlkadateadikqlcdeakkfntasvcvnsywipfvteqlkgtdvnp
iavvgfplgamateseifeattaidqgaeeidmvlnvgelkggndekvladiqgladavh
akgkilkvilenalltkdeivracqlsekagadfvktstgystsgakvedvklmretvgd
rlgvkasggihsreealamidagasrmgvsatvailt

SCOPe Domain Coordinates for d5h91a_:

Click to download the PDB-style file with coordinates for d5h91a_.
(The format of our PDB-style files is described here.)

Timeline for d5h91a_:

  • d5h91a_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-28