SCOPe 2.08: Domain d5fwca1: 5fwc A:6-59

Lineage for d5fwca1 (5fwc A:6-59)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.1: SH3-domain [50045] (40 proteins)

6. Protein automated matches [190043] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187799] (37 PDB entries)

8. Domain d5fwca1: 5fwc A:6-59 [327617]
   Other proteins in same PDB: d5fwca2
   automated match to d2f2va_
   complexed with edo, nh4

Details for d5fwca1

PDB Entry: 5fwc, 1.4 Å

PDB Description: human spectrin sh3 domain d48g, e7a, k60a

PDB Compounds: (A:) spectrin alpha chain, non-erythrocytic 1

SCOPe Domain Sequences for d5fwca1:

Sequence; same for both SEQRES and ATOM records:

>d5fwca1 b.34.2.1 (A:6-59) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kalvlalydyqeksprevtmkkgdiltllnstnkdwwkvevngrqgfvpaayvk

Timeline for d5fwca1:

• d5fwca1 first appeared in SCOPe 2.06
  
• d5fwca1 appears in SCOPe 2.07