SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5f4xd_ (5f4x D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2085156Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2085157Family c.1.10.1: Class I aldolase [51570] (13 protein domains)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 2085377Protein Fructose-1,6-bisphosphate aldolase [51576] (11 species)
  7. 2085436Species Rabbit (Oryctolagus cuniculus), muscle isozyme [TaxId:9986] [51580] (27 PDB entries)
  8. 2284314Domain d5f4xd_: 5f4x D: [327615]
    automated match to d1ewea_
    complexed with gol; mutant

Details for d5f4xd_

PDB Entry: 5f4x (more details), 1.84 Å

PDB Description: fructose-1,6-bisphosphate aldolase k229m mutant from rabbit muscle
PDB Compounds: (D:) Fructose-bisphosphate aldolase A

SCOPe Domain Sequences for d5f4xd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5f4xd_ c.1.10.1 (D:) Fructose-1,6-bisphosphate aldolase {Rabbit (Oryctolagus cuniculus), muscle isozyme [TaxId: 9986]}
phshpaltpeqkkelsdiahrivapgkgilaadestgsiakrlqsigtenteenrrfyrq
llltaddrvnpciggvilfhetlyqkaddgrpfpqvikskggvvgikvdkgvvplagtng
etttqgldglsercaqykkdgadfakwrcvlkigehtpsalaimenanvlaryasicqqn
givpivepeilpdgdhdlkrcqyvtekvlaavykalsdhhiylegtllmpnmvtpghact
qkysheeiamatvtalrrtvppavtgvtflsggqseeeasinlnainkcpllkpwaltfs
ygralqasalkawggkkenlkaaqeeyvkralanslacqgkytpsgqagaaaseslfisn
hay

SCOPe Domain Coordinates for d5f4xd_:

Click to download the PDB-style file with coordinates for d5f4xd_.
(The format of our PDB-style files is described here.)

Timeline for d5f4xd_:

  • d5f4xd_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-29