SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5fh1a1 (5fh1 A:5-259)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2149702Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily)
    contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain
  4. 2149703Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (2 families) (S)
  5. 2149704Family c.109.1.1: PEP carboxykinase N-terminal domain [68924] (3 protein domains)
  6. 2149705Protein Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) [69615] (2 species)
  7. 2149715Species Norway rat (Rattus norvegicus) [TaxId:10116] [225315] (35 PDB entries)
  8. 2284312Domain d5fh1a1: 5fh1 A:5-259 [327613]
    Other proteins in same PDB: d5fh1a2
    automated match to d3dt2a1
    complexed with epe, gtp, mn, na

Details for d5fh1a1

PDB Entry: 5fh1 (more details), 1.55 Å

PDB Description: the structure of rat cytosolic pepck variant e89d in complex with gtp
PDB Compounds: (A:) Phosphoenolpyruvate carboxykinase, cytosolic [GTP]

SCOPe Domain Sequences for d5fh1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fh1a1 c.109.1.1 (A:5-259) Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
lhngldfsakviqgsldslpqevrkfvegnaqlcqpeyihicdgseeeygrllahmqeeg
virklkkydncwlaltdprdvaridsktviitqeqrdtvpipksgqsqlgrwmseedfek
afnarfpgcmkgrtmyvipfsmgplgsplakigieltdspyvvasmrimtrmgtsvleal
gdgefikclhsvgcplplkkplvnnwacnpeltliahlpdrreiisfgsgyggnsllgkk
cfalriasrlakeeg

SCOPe Domain Coordinates for d5fh1a1:

Click to download the PDB-style file with coordinates for d5fh1a1.
(The format of our PDB-style files is described here.)

Timeline for d5fh1a1:

  • d5fh1a1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-28

View in 3D
Domains from same chain:
(mouse over for more information)
d5fh1a2