SCOPe 2.08: Domain d5fh1a1: 5fh1 A:5-259

Lineage for d5fh1a1 (5fh1 A:5-259)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily)
   contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain

4. Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (2 families)

5. Family c.109.1.1: PEP carboxykinase N-terminal domain [68924] (3 proteins)

6. Protein Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) [69615] (2 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [225315] (42 PDB entries)

8. Domain d5fh1a1: 5fh1 A:5-259 [327613]
   Other proteins in same PDB: d5fh1a2
   automated match to d3dt2a1
   complexed with epe, gtp, mn, na

Details for d5fh1a1

PDB Entry: 5fh1, 1.55 Å

PDB Description: the structure of rat cytosolic pepck variant e89d in complex with gtp

PDB Compounds: (A:) Phosphoenolpyruvate carboxykinase, cytosolic [GTP]

SCOPe Domain Sequences for d5fh1a1:

Sequence; same for both SEQRES and ATOM records:

>d5fh1a1 c.109.1.1 (A:5-259) Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
lhngldfsakviqgsldslpqevrkfvegnaqlcqpeyihicdgseeeygrllahmqeeg
virklkkydncwlaltdprdvaridsktviitqeqrdtvpipksgqsqlgrwmseedfek
afnarfpgcmkgrtmyvipfsmgplgsplakigieltdspyvvasmrimtrmgtsvleal
gdgefikclhsvgcplplkkplvnnwacnpeltliahlpdrreiisfgsgyggnsllgkk
cfalriasrlakeeg

Timeline for d5fh1a1:

• d5fh1a1 first appeared in SCOPe 2.06
  
• d5fh1a1 appears in SCOPe 2.07