Lineage for d5fh1a1 (5fh1 A:5-259)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2149702Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily)
    contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain
  4. 2149703Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (2 families) (S)
  5. 2149704Family c.109.1.1: PEP carboxykinase N-terminal domain [68924] (3 protein domains)
  6. 2149705Protein Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) [69615] (2 species)
  7. 2149715Species Norway rat (Rattus norvegicus) [TaxId:10116] [225315] (40 PDB entries)
  8. 2284312Domain d5fh1a1: 5fh1 A:5-259 [327613]
    Other proteins in same PDB: d5fh1a2
    automated match to d3dt2a1
    complexed with epe, gtp, mn, na

Details for d5fh1a1

PDB Entry: 5fh1 (more details), 1.55 Å

PDB Description: the structure of rat cytosolic pepck variant e89d in complex with gtp
PDB Compounds: (A:) Phosphoenolpyruvate carboxykinase, cytosolic [GTP]

SCOPe Domain Sequences for d5fh1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fh1a1 c.109.1.1 (A:5-259) Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
lhngldfsakviqgsldslpqevrkfvegnaqlcqpeyihicdgseeeygrllahmqeeg
virklkkydncwlaltdprdvaridsktviitqeqrdtvpipksgqsqlgrwmseedfek
afnarfpgcmkgrtmyvipfsmgplgsplakigieltdspyvvasmrimtrmgtsvleal
gdgefikclhsvgcplplkkplvnnwacnpeltliahlpdrreiisfgsgyggnsllgkk
cfalriasrlakeeg

SCOPe Domain Coordinates for d5fh1a1:

Click to download the PDB-style file with coordinates for d5fh1a1.
(The format of our PDB-style files is described here.)

Timeline for d5fh1a1:

  • d5fh1a1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-28

View in 3D
Domains from same chain:
(mouse over for more information)
d5fh1a2