SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5fd5d_ (5fd5 D:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982196Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1983660Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 1983661Protein automated matches [190154] (66 species)
    not a true protein
  7. 2284253Species Rhizobium leguminosarum [TaxId:387] [327554] (2 PDB entries)
  8. 2284311Domain d5fd5d_: 5fd5 D: [327612]
    automated match to d4rb2c_
    complexed with edo, so4

Details for d5fd5d_

PDB Entry: 5fd5 (more details), 1.91 Å

PDB Description: manganese uptake regulator
PDB Compounds: (D:) ferric uptake regulation protein

SCOPe Domain Sequences for d5fd5d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fd5d_ a.4.5.0 (D:) automated matches {Rhizobium leguminosarum [TaxId: 387]}
aktleelatergmrmteqrrviariledsedhpdveelyrrsvkvdakisistvyrtvkl
fedagiiarhdfrdgrsryetvpeehhdhlidlktgtviefrspeiealqeriarehgfr
lvdhrlelygvpl

SCOPe Domain Coordinates for d5fd5d_:

Click to download the PDB-style file with coordinates for d5fd5d_.
(The format of our PDB-style files is described here.)

Timeline for d5fd5d_:

  • d5fd5d_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-28