Lineage for d5h91b_ (5h91 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2085156Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2086456Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2086457Protein automated matches [190115] (75 species)
    not a true protein
  7. 2284308Species Lactobacillus brevis [TaxId:1580] [327609] (1 PDB entry)
  8. 2284309Domain d5h91b_: 5h91 B: [327610]
    automated match to d3ng3d_
    complexed with acy; mutant

Details for d5h91b_

PDB Entry: 5h91 (more details), 1.77 Å

PDB Description: lbdera mutant-t29l/f163y
PDB Compounds: (B:) deoxyribose-phosphate aldolase

SCOPe Domain Sequences for d5h91b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h91b_ c.1.10.0 (B:) automated matches {Lactobacillus brevis [TaxId: 1580]}
ltteqlakyidhtnlkadateadikqlcdeakkfntasvcvnsywipfvteqlkgtdvnp
iavvgfplgamateseifeattaidqgaeeidmvlnvgelkggndekvladiqgladavh
akgkilkvilenalltkdeivracqlsekagadfvktstgystsgakvedvklmretvgd
rlgvkasggihsreealamidagasrmgvsatvailt

SCOPe Domain Coordinates for d5h91b_:

Click to download the PDB-style file with coordinates for d5h91b_.
(The format of our PDB-style files is described here.)

Timeline for d5h91b_:

  • d5h91b_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-28