SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5gped_ (5gpe D:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1985062Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)
    core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different
  4. 1985063Superfamily a.6.1: Putative DNA-binding domain [46955] (8 families) (S)
  5. 1985178Family a.6.1.0: automated matches [191604] (1 protein)
    not a true family
  6. 1985179Protein automated matches [191102] (5 species)
    not a true protein
  7. 2284260Species Cupriavidus metallidurans [TaxId:266264] [327561] (1 PDB entry)
  8. 2284307Domain d5gped_: 5gpe D: [327608]
    automated match to d1q06a_
    complexed with pb

Details for d5gped_

PDB Entry: 5gpe (more details), 2.01 Å

PDB Description: crystal structure of the transcription regulator pbrr691 from ralstonia metallidurans ch34 in complex with lead(ii)
PDB Compounds: (D:) Transcriptional regulator, MerR-family

SCOPe Domain Sequences for d5gped_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gped_ a.6.1.0 (D:) automated matches {Cupriavidus metallidurans [TaxId: 266264]}
mmrigelgkkadclvqtvrfyesegllpeparsegnfrlydevhlqrllfirrcrakdmt
ldeirqllnlrdrpelgcgevnalvdahiaqvrtkmkelralerelmdlrrscdsartsr
ecgilnsla

SCOPe Domain Coordinates for d5gped_:

Click to download the PDB-style file with coordinates for d5gped_.
(The format of our PDB-style files is described here.)

Timeline for d5gped_:

  • d5gped_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-28