SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5infd2 (5inf D:264-532)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2099098Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2099099Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2100042Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2100043Protein automated matches [190246] (53 species)
    not a true protein
  7. 2284282Species Streptomyces ambofaciens [TaxId:278992] [327583] (3 PDB entries)
  8. 2284302Domain d5infd2: 5inf D:264-532 [327603]
    automated match to d3iava2
    complexed with hxc

Details for d5infd2

PDB Entry: 5inf (more details), 2.75 Å

PDB Description: structural basis for acyl-coa carboxylase-mediated assembly of unusual polyketide synthase extender units incorporated into the stambomycin antibiotics
PDB Compounds: (D:) Carboxyl transferase

SCOPe Domain Sequences for d5infd2:

Sequence, based on SEQRES records: (download)

>d5infd2 c.14.1.0 (D:264-532) automated matches {Streptomyces ambofaciens [TaxId: 278992]}
ldpapvydhdcapgiteadlaldtvipdseqqvydmadvitavlddgdyleihpdfarni
icalgrveghsvavvanqprhlagvldidasekaarfirfcdsfnipvltfmdvpgylpg
vgqehqgiirrgiklfyayaestvpkitvitrkaygggyavmgsrqigadrvmawptaei
avmgansavpilhrrelaavppeeraavkenlvddyrrrfgnpyeaaahgyvdmvispsr
tryevaralaslrnkrqarparkhgnipl

Sequence, based on observed residues (ATOM records): (download)

>d5infd2 c.14.1.0 (D:264-532) automated matches {Streptomyces ambofaciens [TaxId: 278992]}
ldpapvydhdcapgiteadlaldtvipdseqqvydmadvitavlddgdyleihpdfarni
icalgrveghsvavvanqprhlagvldidasekaarfirfcdsfnipvltfmdvpgylpg
vgqehqgiirrgiklfyayaestvpkitvitrkaygggyavmgsrqigadrvmawptaei
avmgarrrfgnpyeaaahgyvdmvispsrtryevaralaslrnkrqarparkhgnipl

SCOPe Domain Coordinates for d5infd2:

Click to download the PDB-style file with coordinates for d5infd2.
(The format of our PDB-style files is described here.)

Timeline for d5infd2:

  • d5infd2 appears in periodic updates to SCOPe 2.06 starting on 2016-12-29