Lineage for d5infd1 (5inf D:15-263)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2099098Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2099099Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2100042Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2100043Protein automated matches [190246] (53 species)
    not a true protein
  7. 2284282Species Streptomyces ambofaciens [TaxId:278992] [327583] (3 PDB entries)
  8. 2284301Domain d5infd1: 5inf D:15-263 [327602]
    automated match to d3iava1
    complexed with hxc

Details for d5infd1

PDB Entry: 5inf (more details), 2.75 Å

PDB Description: structural basis for acyl-coa carboxylase-mediated assembly of unusual polyketide synthase extender units incorporated into the stambomycin antibiotics
PDB Compounds: (D:) Carboxyl transferase

SCOPe Domain Sequences for d5infd1:

Sequence, based on SEQRES records: (download)

>d5infd1 c.14.1.0 (D:15-263) automated matches {Streptomyces ambofaciens [TaxId: 278992]}
tstadriadlaarheeavvlaekkaadrqhlkgkltararidllldpgsfveldefvrhr
tveagiprpygdgvvtghgtidgrqvcvfshdfttlggsmgeafgskvvkiydfamsvgc
pvigindsggariqegvmsiayytelgvrnvhssgvipqislimgpcaggsvyspaltdf
tvmvkdisymfvtgpevvsavmgeqvtaeqlggpavhaevsgnahyvgddeqdaiswvqt
llgylppnn

Sequence, based on observed residues (ATOM records): (download)

>d5infd1 c.14.1.0 (D:15-263) automated matches {Streptomyces ambofaciens [TaxId: 278992]}
tstadriadlaarheeavvlaekkaadrqhlkgkltararidllldpgsfveldefvrhr
tiprpygdgvvtghgtidgrqvcvfshdfttlggsmgeafgskvvkiydfamsvgcpvig
indsggariqegvmsiayytelgvrnvhssgvipqislimgpcaggsvyspaltdftvmv
kdisymfvtgpevvsaqvtaeqlggpavhaevsgnahyvgddeqdaiswvqtllgylppn
n

SCOPe Domain Coordinates for d5infd1:

Click to download the PDB-style file with coordinates for d5infd1.
(The format of our PDB-style files is described here.)

Timeline for d5infd1:

  • d5infd1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-29