SCOPe 2.06: Domain d5fbaa_: 5fba A:

Lineage for d5fbaa_ (5fba A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.124: Phospholipase C/P1 nuclease [48536] (1 superfamily)
   multihelical

4. Superfamily a.124.1: Phospholipase C/P1 nuclease [48537] (3 families)
   duplication: all chain but the N-terminal helix forms two structural repeats

5. Family a.124.1.0: automated matches [194368] (1 protein)
   not a true family

6. Protein automated matches [194369] (3 species)
   not a true protein

7. Species Aspergillus oryzae [TaxId:510516] [327581] (7 PDB entries)

8. Domain d5fbaa_: 5fba A: [327593]
   automated match to d1ak0a_
   complexed with gol, nag, po4, zn

Details for d5fbaa_

PDB Entry: 5fba, 1.8 Å

PDB Description: s1 nuclease from aspergillus oryzae in complex with phosphate

PDB Compounds: (A:) Nuclease S1

SCOPe Domain Sequences for d5fbaa_:

Sequence; same for both SEQRES and ATOM records:

>d5fbaa_ a.124.1.0 (A:) automated matches {Aspergillus oryzae [TaxId: 510516]}
wgnlghetvayiaqsfvasstesfcqnilgddstsylanvatwadtykytdagefskpyh
fidaqdnppqscgvdydrdcgsagcsisaiqnytnillespngsealnalkfvvhiigdi
hqplhdenleaggngidvtydgettnlhhiwdtnmpeeaaggyslsvaktyadllterik
tgtysskkdswtdgidikdpvstsmiwaadantyvcstvlddglayinstdlsgeyydks
qpvfeeliakagyrlaawldliasqp

Timeline for d5fbaa_:

• d5fbaa_ is new in SCOPe 2.06-stable
  
• d5fbaa_ appears in SCOPe 2.07
  
• d5fbaa_ appears in the current release, SCOPe 2.08