SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5fbaa_ (5fba A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2009738Fold a.124: Phospholipase C/P1 nuclease [48536] (1 superfamily)
    multihelical
  4. 2009739Superfamily a.124.1: Phospholipase C/P1 nuclease [48537] (3 families) (S)
    duplication: all chain but the N-terminal helix forms two structural repeats
  5. 2009774Family a.124.1.0: automated matches [194368] (1 protein)
    not a true family
  6. 2009775Protein automated matches [194369] (3 species)
    not a true protein
  7. 2284280Species Aspergillus oryzae [TaxId:510516] [327581] (7 PDB entries)
  8. 2284292Domain d5fbaa_: 5fba A: [327593]
    automated match to d1ak0a_
    complexed with gol, nag, po4, zn

Details for d5fbaa_

PDB Entry: 5fba (more details), 1.8 Å

PDB Description: s1 nuclease from aspergillus oryzae in complex with phosphate
PDB Compounds: (A:) Nuclease S1

SCOPe Domain Sequences for d5fbaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fbaa_ a.124.1.0 (A:) automated matches {Aspergillus oryzae [TaxId: 510516]}
wgnlghetvayiaqsfvasstesfcqnilgddstsylanvatwadtykytdagefskpyh
fidaqdnppqscgvdydrdcgsagcsisaiqnytnillespngsealnalkfvvhiigdi
hqplhdenleaggngidvtydgettnlhhiwdtnmpeeaaggyslsvaktyadllterik
tgtysskkdswtdgidikdpvstsmiwaadantyvcstvlddglayinstdlsgeyydks
qpvfeeliakagyrlaawldliasqp

SCOPe Domain Coordinates for d5fbaa_:

Click to download the PDB-style file with coordinates for d5fbaa_.
(The format of our PDB-style files is described here.)

Timeline for d5fbaa_:

  • d5fbaa_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-28