Lineage for d1tru__ (1tru -)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 315307Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 315308Superfamily c.47.1: Thioredoxin-like [52833] (12 families) (S)
  5. 315309Family c.47.1.1: Thioltransferase [52834] (7 proteins)
  6. 315343Protein Thioredoxin [52835] (7 species)
  7. 315371Species Human (Homo sapiens) [TaxId:9606] [52842] (18 PDB entries)
  8. 315384Domain d1tru__: 1tru - [32758]
    mutant

Details for d1tru__

PDB Entry: 1tru (more details)

PDB Description: the high-resolution three-dimensional solution structures of the oxidized and reduced states of human thioredoxin

SCOP Domain Sequences for d1tru__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tru__ c.47.1.1 (-) Thioredoxin {Human (Homo sapiens)}
mvkqiesktafqealdaagdklvvvdfsatwcgpckmikpffhslsekysnviflevdvd
daqdvaseaevkatptfqffkkgqkvgefsgankekleatinelv

SCOP Domain Coordinates for d1tru__:

Click to download the PDB-style file with coordinates for d1tru__.
(The format of our PDB-style files is described here.)

Timeline for d1tru__: