SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5h9ga1 (5h9g A:1-76)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1991985Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 1991986Superfamily a.28.1: ACP-like [47336] (4 families) (S)
  5. 1992102Family a.28.1.0: automated matches [191582] (1 protein)
    not a true family
  6. 1992103Protein automated matches [191038] (20 species)
    not a true protein
  7. 2284270Species Helicobacter pylori [TaxId:570508] [327571] (2 PDB entries)
  8. 2284273Domain d5h9ga1: 5h9g A:1-76 [327574]
    Other proteins in same PDB: d5h9ga2, d5h9gb2
    automated match to d3gzmb_

Details for d5h9ga1

PDB Entry: 5h9g (more details), 2.6 Å

PDB Description: apo-acp from helicobacter pylori
PDB Compounds: (A:) Acyl carrier protein

SCOPe Domain Sequences for d5h9ga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h9ga1 a.28.1.0 (A:1-76) automated matches {Helicobacter pylori [TaxId: 570508]}
malfediqaviaeqlnvdaaqvtpeaefvkdlgadsldvvelimaleekfgieipdeqae
kivnvgdvvkyiednk

SCOPe Domain Coordinates for d5h9ga1:

Click to download the PDB-style file with coordinates for d5h9ga1.
(The format of our PDB-style files is described here.)

Timeline for d5h9ga1:

  • d5h9ga1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-28

View in 3D
Domains from same chain:
(mouse over for more information)
d5h9ga2