SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5b21b_ (5b21 B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2017117Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2019634Protein automated matches [190119] (22 species)
    not a true protein
  7. 2020203Species Mouse (Mus musculus) [TaxId:10090] [186842] (155 PDB entries)
  8. 2284263Domain d5b21b_: 5b21 B: [327564]
    automated match to d1neua_

Details for d5b21b_

PDB Entry: 5b21 (more details), 2.24 Å

PDB Description: dimer structure of murine nectin-1 d1
PDB Compounds: (B:) murine Nectin-1 D1

SCOPe Domain Sequences for d5b21b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b21b_ b.1.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qvvqvndsmygfigtdvvlhcsfanplpsvkitqvtwqkasngskqnmaiynptmgvsvl
ppyekrveflrpsfidgtirlsgleledegmyicefatfptgnresqlnltvma

SCOPe Domain Coordinates for d5b21b_:

Click to download the PDB-style file with coordinates for d5b21b_.
(The format of our PDB-style files is described here.)

Timeline for d5b21b_:

  • d5b21b_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-28

View in 3D
Domains from other chains:
(mouse over for more information)
d5b21a_