SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5fw9a_ (5fw9 A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2045654Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2045783Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2045784Family b.34.2.1: SH3-domain [50045] (40 protein domains)
  6. 2046151Protein automated matches [190043] (6 species)
    not a true protein
  7. 2046175Species Human (Homo sapiens) [TaxId:9606] [187799] (27 PDB entries)
  8. 2284262Domain d5fw9a_: 5fw9 A: [327563]
    automated match to d2f2va_

Details for d5fw9a_

PDB Entry: 5fw9 (more details), 1.55 Å

PDB Description: human spectrin sh3 domain d48g, e7y, k60y
PDB Compounds: (A:) spectrin alpha chain, non-erythrocytic 1

SCOPe Domain Sequences for d5fw9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fw9a_ b.34.2.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kylvlalydyqeksprevtmkkgdiltllnstnkdwwkvevngrqgfvpaayvkyld

SCOPe Domain Coordinates for d5fw9a_:

Click to download the PDB-style file with coordinates for d5fw9a_.
(The format of our PDB-style files is described here.)

Timeline for d5fw9a_:

  • d5fw9a_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-28