Lineage for d5fw9a_ (5fw9 A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2045654Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2045783Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2045784Family b.34.2.1: SH3-domain [50045] (40 protein domains)
  6. 2046151Protein automated matches [190043] (6 species)
    not a true protein
  7. 2046175Species Human (Homo sapiens) [TaxId:9606] [187799] (30 PDB entries)
  8. 2284262Domain d5fw9a_: 5fw9 A: [327563]
    automated match to d2f2va_

Details for d5fw9a_

PDB Entry: 5fw9 (more details), 1.55 Å

PDB Description: human spectrin sh3 domain d48g, e7y, k60y
PDB Compounds: (A:) spectrin alpha chain, non-erythrocytic 1

SCOPe Domain Sequences for d5fw9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fw9a_ b.34.2.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kylvlalydyqeksprevtmkkgdiltllnstnkdwwkvevngrqgfvpaayvkyld

SCOPe Domain Coordinates for d5fw9a_:

Click to download the PDB-style file with coordinates for d5fw9a_.
(The format of our PDB-style files is described here.)

Timeline for d5fw9a_:

  • d5fw9a_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-28