Lineage for d1cqga_ (1cqg A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 24115Fold c.47: Thioredoxin fold [52832] (3 superfamilies)
  4. 24116Superfamily c.47.1: Thioredoxin-like [52833] (10 families) (S)
  5. 24117Family c.47.1.1: Thioltransferase [52834] (2 proteins)
  6. 24138Protein Thioredoxin [52835] (7 species)
  7. 24160Species Human (Homo sapiens) [TaxId:9606] [52842] (17 PDB entries)
  8. 24174Domain d1cqga_: 1cqg A: [32756]

Details for d1cqga_

PDB Entry: 1cqg (more details)

PDB Description: high resolution solution nmr structure of mixed disulfide intermediate between human thioredoxin (c35a, c62a, c69a, c73a) mutant and a 13 residue peptide comprising its target site in human ref-1 (residues 59-71 of the p50 subunit of nfkb), nmr, 31 structures

SCOP Domain Sequences for d1cqga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cqga_ c.47.1.1 (A:) Thioredoxin {Human (Homo sapiens)}
mvkqiesktafqealdaagdklvvvdfsatwcgpakmikpffhslsekysnviflevdvd
daqdvaseaevkatptfqffkkgqkvgefsgankekleatinelv

SCOP Domain Coordinates for d1cqga_:

Click to download the PDB-style file with coordinates for d1cqga_.
(The format of our PDB-style files is described here.)

Timeline for d1cqga_: