Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) contains a small beta-sheet (wing) |
Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
Protein automated matches [190154] (92 species) not a true protein |
Species Rhizobium leguminosarum [TaxId:387] [327554] (2 PDB entries) |
Domain d5fd5e_: 5fd5 E: [327559] automated match to d4rb2c_ complexed with edo, so4 |
PDB Entry: 5fd5 (more details), 1.91 Å
SCOPe Domain Sequences for d5fd5e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5fd5e_ a.4.5.0 (E:) automated matches {Rhizobium leguminosarum [TaxId: 387]} tleelatergmrmteqrrviariledsedhpdveelyrrsvkvdakisistvyrtvklfe dagiiarhdfrdgrsryetvpeehhdhlidlktgtviefrspeiealqeriarehgfrlv dhrlelygvplk
Timeline for d5fd5e_:
View in 3D Domains from other chains: (mouse over for more information) d5fd5a_, d5fd5b_, d5fd5c_, d5fd5d_ |