SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5fdhb1 (5fdh B:22-265)

  1. Root: SCOPe 2.06
  2. 2217451Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2217740Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2217741Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2218831Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 2218832Protein automated matches [190857] (38 species)
    not a true protein
  7. 2284255Species Serratia marcescens [TaxId:615] [327556] (1 PDB entry)
  8. 2284256Domain d5fdhb1: 5fdh B:22-265 [327557]
    Other proteins in same PDB: d5fdha2, d5fdhb2
    automated match to d4s2na_
    complexed with gol, so4

Details for d5fdhb1

PDB Entry: 5fdh (more details), 2.26 Å

PDB Description: crystal structure of oxa-405 beta-lactamase
PDB Compounds: (B:) Beta-lactamase

SCOPe Domain Sequences for d5fdhb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fdhb1 e.3.1.0 (B:22-265) automated matches {Serratia marcescens [TaxId: 615]}
mkewqenkswnahftehksqgvvvlwnenkqqgftnnlkranqaflpastfkipnslial
dlgvvkdehqvfkwdgqtrdiatwnrdhnlitamkysvvpvyqefarqigearmskmlha
fdygnedisgnvdsfwldggirisateqisflrklyhnklhvsersqrivkqamlteang
dyiiraktgyspkigwwvgwvelddnvwffamnmdmptsdglglrqaitkevlkqekiip

SCOPe Domain Coordinates for d5fdhb1:

Click to download the PDB-style file with coordinates for d5fdhb1.
(The format of our PDB-style files is described here.)

Timeline for d5fdhb1:

  • d5fdhb1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-28

View in 3D
Domains from same chain:
(mouse over for more information)
d5fdhb2