Lineage for d5b1za_ (5b1z A:)

  1. Root: SCOPe 2.06
  2. 2223823Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2223824Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 2223896Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) (S)
    PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain
  5. 2223897Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 protein domains)
    Pfam PF00452
  6. 2224027Protein automated matches [190236] (4 species)
    not a true protein
  7. 2224028Species Human (Homo sapiens) [TaxId:9606] [188722] (49 PDB entries)
  8. 2284249Domain d5b1za_: 5b1z A: [327550]
    automated match to d4z9vb_

Details for d5b1za_

PDB Entry: 5b1z (more details), 2.15 Å

PDB Description: crystal structure of bcl-xl in complex with hbx-bh3 motif
PDB Compounds: (A:) Bcl-2-like protein 1

SCOPe Domain Sequences for d5b1za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b1za_ f.1.4.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
msqsnrelvvdflsyklsqkgyswsqmaavkqalreagdefelryrrafsdltsqlhitp
gtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaawmatylnd
hlepwiqenggwdtfvelygnnaa

SCOPe Domain Coordinates for d5b1za_:

Click to download the PDB-style file with coordinates for d5b1za_.
(The format of our PDB-style files is described here.)

Timeline for d5b1za_:

  • d5b1za_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-28

View in 3D
Domains from other chains:
(mouse over for more information)
d5b1zb_