SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5b1za_ (5b1z A:)

  1. Root: SCOPe 2.06
  2. 2223823Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2223824Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 2223896Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) (S)
    PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain
  5. 2223897Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 protein domains)
    Pfam PF00452
  6. 2224027Protein automated matches [190236] (4 species)
    not a true protein
  7. 2224028Species Human (Homo sapiens) [TaxId:9606] [188722] (46 PDB entries)
  8. 2284249Domain d5b1za_: 5b1z A: [327550]
    automated match to d4z9vb_

Details for d5b1za_

PDB Entry: 5b1z (more details), 2.15 Å

PDB Description: crystal structure of bcl-xl in complex with hbx-bh3 motif
PDB Compounds: (A:) Bcl-2-like protein 1

SCOPe Domain Sequences for d5b1za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b1za_ f.1.4.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
msqsnrelvvdflsyklsqkgyswsqmaavkqalreagdefelryrrafsdltsqlhitp
gtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaawmatylnd
hlepwiqenggwdtfvelygnnaa

SCOPe Domain Coordinates for d5b1za_:

Click to download the PDB-style file with coordinates for d5b1za_.
(The format of our PDB-style files is described here.)

Timeline for d5b1za_:

  • d5b1za_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-28

View in 3D
Domains from other chains:
(mouse over for more information)
d5b1zb_