SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tjxa_ (5tjx A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2055877Family b.47.1.2: Eukaryotic proteases [50514] (49 protein domains)
  6. 2057491Protein automated matches [190044] (14 species)
    not a true protein
  7. 2057530Species Human (Homo sapiens) [TaxId:9606] [187233] (142 PDB entries)
  8. 2284245Domain d5tjxa_: 5tjx A: [327546]
    automated match to d1qrza_
    complexed with gbt, po4

Details for d5tjxa_

PDB Entry: 5tjx (more details), 1.41 Å

PDB Description: structure of human plasma kallikrein
PDB Compounds: (A:) Plasma kallikrein

SCOPe Domain Sequences for d5tjxa_:

Sequence, based on SEQRES records: (download)

>d5tjxa_ b.47.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ivggtesswgewpwqvslqvkltaqrhlcggslighqwvltaahcfdglplqdvwriysg
ilelsditkdtpfsqikeiiihqnykvsegnhdialiklqapleytefqkpislpskgdt
stiytncwvtgwgfskekgeiqnilqkvniplvtneecqkryqdykitqrmvcagykegg
kdackgdsggplvckhngmwrlvgitswgegcarreqpgvytkvaeymdwilektq

Sequence, based on observed residues (ATOM records): (download)

>d5tjxa_ b.47.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ivggtesswgewpwqvslqvkltaqrhlcggslighqwvltaahcfdglplqdvwriysg
ilelsditkdtpfsqikeiiihqnykvsegnhdialiklqapleytefqkpislpstiyt
ncwvtgwgfskekgeiqnilqkvniplvtneecqkryqdykitqrmvcagykeggkdack
gdsggplvckhngmwrlvgitswgegcarreqpgvytkvaeymdwilektq

SCOPe Domain Coordinates for d5tjxa_:

Click to download the PDB-style file with coordinates for d5tjxa_.
(The format of our PDB-style files is described here.)

Timeline for d5tjxa_:

  • d5tjxa_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-22