Lineage for d5wrfd_ (5wrf D:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2438294Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2440429Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (2 families) (S)
  5. 2440879Family c.23.13.0: automated matches [191662] (1 protein)
    not a true family
  6. 2440880Protein automated matches [191250] (4 species)
    not a true protein
  7. 2440881Species Acinetobacter baumannii [TaxId:400667] [260788] (7 PDB entries)
  8. 2440913Domain d5wrfd_: 5wrf D: [327545]
    automated match to d4rc9a_
    complexed with edo

Details for d5wrfd_

PDB Entry: 5wrf (more details), 2.51 Å

PDB Description: crystal structure of dodecameric type ii dehydroquinate dehydratase from acinetobacter baumannii with unexplained connecting electron density between free cysteine residues of molecular pairs
PDB Compounds: (D:) 3-dehydroquinate dehydratase

SCOPe Domain Sequences for d5wrfd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wrfd_ c.23.13.0 (D:) automated matches {Acinetobacter baumannii [TaxId: 400667]}
sstilvihgpnlnllgkrepevyghltldninrqliaqaeqasitldtfqsnwegaivdr
ihqaqtegvkliiinpaalthtsvalrdallgvaipfievhlsnvhareafrhhsylsdk
aigvicglgakgysfaldyaiekiq

SCOPe Domain Coordinates for d5wrfd_:

Click to download the PDB-style file with coordinates for d5wrfd_.
(The format of our PDB-style files is described here.)

Timeline for d5wrfd_: