SCOP 1.69: Domain d4trx__: 4trx -

Lineage for d4trx__ (4trx -)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (15 families)

5. Family c.47.1.1: Thioltransferase [52834] (11 proteins)

6. Protein Thioredoxin [52835] (10 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52842] (18 PDB entries)

8. Domain d4trx__: 4trx - [32754]

Details for d4trx__

PDB Entry: 4trx

PDB Description: high-resolution three-dimensional structure of reduced recombinant human thioredoxin in solution

SCOP Domain Sequences for d4trx__:

Sequence; same for both SEQRES and ATOM records:

>d4trx__ c.47.1.1 (-) Thioredoxin {Human (Homo sapiens)}
mvkqiesktafqealdaagdklvvvdfsatwcgpckmikpffhslsekysnviflevdvd
dcqdvasecevkctptfqffkkgqkvgefsgankekleatinelv

Timeline for d4trx__:

• d4trx__ first appeared (with stable ids) in SCOP 1.55
  
• d4trx__ appears in SCOP 1.67
  
• d4trx__ appears in SCOP 1.71
  
• d4trx__ appears in the current release, SCOPe 2.08, called d4trxa_