Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) |
Family d.22.1.0: automated matches [191400] (1 protein) not a true family |
Protein automated matches [190526] (21 species) not a true protein |
Species Amphioxus (Branchiostoma lanceolatum) [TaxId:7740] [227942] (7 PDB entries) |
Domain d5ltpf1: 5ltp F:0-219 [327538] Other proteins in same PDB: d5ltpb2, d5ltpc2, d5ltpd2, d5ltpe2, d5ltpf2 automated match to d3neda_ complexed with cl, flc |
PDB Entry: 5ltp (more details), 1.7 Å
SCOPe Domain Sequences for d5ltpf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ltpf1 d.22.1.0 (F:0-219) automated matches {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} maslpathelhifgsingvdfdmvgqgtgnpndgyeelnlkstkgdlqfspwilvphigy gfhqylpypdgmspfqaamvdgsgyqvhrtmqfedgasltvnyrytyegshikgeaqvkg tgfpadgpvmtnsltaadwcrskktypndktiistfkwsyttgngkryrstarttytfak pmaanylknqpmyvfrktelkhsktelnfkewqkaftdvm
Timeline for d5ltpf1: