SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tr5a_ (5tr5 A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2158219Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2158220Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2158221Family d.15.1.1: Ubiquitin-related [54237] (39 protein domains)
    Pfam PF00240
  6. 2158890Protein Ubiquitin-like domain of parkin [89831] (2 species)
  7. 2158891Species Human (Homo sapiens) [TaxId:9606] [89832] (2 PDB entries)
  8. 2284236Domain d5tr5a_: 5tr5 A: [327537]
    automated match to d1iyfa_

Details for d5tr5a_

PDB Entry: 5tr5 (more details)

PDB Description: solution structure of serine 65 phosphorylated ubl domain from parkin
PDB Compounds: (A:) E3 ubiquitin-protein ligase parkin

SCOPe Domain Sequences for d5tr5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tr5a_ d.15.1.1 (A:) Ubiquitin-like domain of parkin {Human (Homo sapiens) [TaxId: 9606]}
mivfvrfnsshgfpvevdsdtsifqlkevvakrqgvpadqlrvifagkelrndwtvqncd
ldqqsivhivqrpwrk

SCOPe Domain Coordinates for d5tr5a_:

Click to download the PDB-style file with coordinates for d5tr5a_.
(The format of our PDB-style files is described here.)

Timeline for d5tr5a_:

  • d5tr5a_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-22