Class b: All beta proteins [48724] (180 folds) |
Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
Superfamily b.85.7: SET domain [82199] (4 families) duplication: the core is composed of two structural repeats similar to (circularly permuted) repeats of AFPIII also contains a substrate-binding alpha+beta subdomain inserted in the core Pfam PF00856 |
Family b.85.7.0: automated matches [227191] (1 protein) not a true family |
Protein automated matches [226914] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225158] (28 PDB entries) |
Domain d5ttfb_: 5ttf B: [327535] automated match to d3k5ka_ complexed with 7kz, cl, sam, unx, zn |
PDB Entry: 5ttf (more details), 1.72 Å
SCOPe Domain Sequences for d5ttfb_:
Sequence, based on SEQRES records: (download)
>d5ttfb_ b.85.7.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} tekiicrdvargyenvpipcvngvdgepcpedykyisencetstmnidrnithlqhctcv ddcsssnclcgqlsircwydkdgrllqefnkiepplifecnqacscwrncknrvvqsgik vrlqlyrtakmgwgvralqtipqgtficeyvgelisdaeadvreddsylfdldnkdgevy cidaryygnisrfinhlcdpniipvrvfmlhqdlrfpriaffssrdirtgeelgfdygdr fwdikskyftcqcgsekckhsaeaialeqsr
>d5ttfb_ b.85.7.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} tekiicrdvargyenvpipcvngvdgepcpedykyisencetstmnidrnithlqhctcv ddcsssnclcgqlsircwydkdgrllqefnkiepplifecnqacscwrncknrvvqsgik vrlqlyrtakmgwgvralqtipqgtficeyvgelisdaeadvreddsylfdldnevycid aryygnisrfinhlcdpniipvrvfmlhqdlrfpriaffssrdirtgeelgfdygdrfwd ikskyftcqcgsekckhsaeaialeqsr
Timeline for d5ttfb_: