SCOP 1.71: Domain d1trs__: 1trs -

Lineage for d1trs__ (1trs -)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (16 families)

5. Family c.47.1.1: Thioltransferase [52834] (13 proteins)

6. Protein Thioredoxin [52835] (12 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52842] (18 PDB entries)

8. Domain d1trs__: 1trs - [32753]
   mutant

Details for d1trs__

PDB Entry: 1trs

PDB Description: the high-resolution three-dimensional solution structures of the oxidized and reduced states of human thioredoxin

SCOP Domain Sequences for d1trs__:

Sequence; same for both SEQRES and ATOM records:

>d1trs__ c.47.1.1 (-) Thioredoxin {Human (Homo sapiens)}
mvkqiesktafqealdaagdklvvvdfsatwcgpckmikpffhslsekysnviflevdvd
daqdvaseaevkatptfqffkkgqkvgefsgankekleatinelv

Timeline for d1trs__:

• d1trs__ first appeared (with stable ids) in SCOP 1.55
  
• d1trs__ appears in SCOP 1.69
  
• d1trs__ is called d1trsa_ in SCOP 1.73
  
• d1trs__ appears in the current release, SCOPe 2.08, called d1trsa_