Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214 |
Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) |
Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins) |
Protein automated matches [190054] (13 species) not a true protein |
Species Pyrococcus furiosus [TaxId:2261] [327480] (1 PDB entry) |
Domain d5t6md_: 5t6m D: [327528] Other proteins in same PDB: d5t6mc2 automated match to d1v8zb_ complexed with 78u, na, po4 |
PDB Entry: 5t6m (more details), 1.8 Å
SCOPe Domain Sequences for d5t6md_:
Sequence, based on SEQRES records: (download)
>d5t6md_ c.79.1.1 (D:) automated matches {Pyrococcus furiosus [TaxId: 2261]} mwfgefggqyvpetlieplkelekaykrfkddeefnrqlnyylktwagrptplyyakrlt ekiggakiylkredlvhggahktnnaigqallakfmgktrliaetgagqhgvatamagal lgmkvdiymgaedverqkmnvfrmkllganvipvnsgsrtlkdainealrdwvatfeyth yligsvvgphpyptivrdfqsvigreakaqileaegqlpdvivacvgggsnamgifypfv ndkkvklvgveaggkglesgkhsaslnagqvgvfhgmlsyflqdeegqikpthsiapgld ypgvgpehaylkkiqraeyvtvtdeealkafhelsrtegiipalesahavayamklakem srdeiiivnlsgrgdkdldivlkvs
>d5t6md_ c.79.1.1 (D:) automated matches {Pyrococcus furiosus [TaxId: 2261]} mwfgefggqyvpetlieplkelekaykrfkddeefnrqlnyylktwagrptplyyakrlt ekiggakiylkredlvhggahktnnaigqallakfmgktrliaetgagqhgvatamagal lgmkvdiymgaedverqkmnvfrmkllganvipvnsgsrtlkdainealrdwvatfeyth yligsvvgphpyptivrdfqsvigreakaqileaegqlpdvivacvgggsnamgifypfv ndkkvklvgveaggkglesgkhsaslnagqvgvfhgmlsyflqdqikpthsiapgldypg vgpehaylkkiqraeyvtvtdeealkafhelsrtegiipalesahavayamklakemsrd eiiivnlsgrgdkdldivlkvs
Timeline for d5t6md_:
View in 3D Domains from other chains: (mouse over for more information) d5t6ma_, d5t6mb_, d5t6mc1, d5t6mc2 |