SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5t6md_ (5t6m D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2139769Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2139770Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2139771Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 protein domains)
  6. 2140010Protein automated matches [190054] (13 species)
    not a true protein
  7. 2284179Species Pyrococcus furiosus [TaxId:2261] [327480] (1 PDB entry)
  8. 2284227Domain d5t6md_: 5t6m D: [327528]
    Other proteins in same PDB: d5t6mc2
    automated match to d1v8zb_
    complexed with 78u, na, po4

Details for d5t6md_

PDB Entry: 5t6m (more details), 1.8 Å

PDB Description: structure of the tryptophan synthase b-subunit from pyroccus furiosus with b-methyltryptophan non-covalently bound
PDB Compounds: (D:) Tryptophan synthase beta chain 1

SCOPe Domain Sequences for d5t6md_:

Sequence, based on SEQRES records: (download)

>d5t6md_ c.79.1.1 (D:) automated matches {Pyrococcus furiosus [TaxId: 2261]}
mwfgefggqyvpetlieplkelekaykrfkddeefnrqlnyylktwagrptplyyakrlt
ekiggakiylkredlvhggahktnnaigqallakfmgktrliaetgagqhgvatamagal
lgmkvdiymgaedverqkmnvfrmkllganvipvnsgsrtlkdainealrdwvatfeyth
yligsvvgphpyptivrdfqsvigreakaqileaegqlpdvivacvgggsnamgifypfv
ndkkvklvgveaggkglesgkhsaslnagqvgvfhgmlsyflqdeegqikpthsiapgld
ypgvgpehaylkkiqraeyvtvtdeealkafhelsrtegiipalesahavayamklakem
srdeiiivnlsgrgdkdldivlkvs

Sequence, based on observed residues (ATOM records): (download)

>d5t6md_ c.79.1.1 (D:) automated matches {Pyrococcus furiosus [TaxId: 2261]}
mwfgefggqyvpetlieplkelekaykrfkddeefnrqlnyylktwagrptplyyakrlt
ekiggakiylkredlvhggahktnnaigqallakfmgktrliaetgagqhgvatamagal
lgmkvdiymgaedverqkmnvfrmkllganvipvnsgsrtlkdainealrdwvatfeyth
yligsvvgphpyptivrdfqsvigreakaqileaegqlpdvivacvgggsnamgifypfv
ndkkvklvgveaggkglesgkhsaslnagqvgvfhgmlsyflqdqikpthsiapgldypg
vgpehaylkkiqraeyvtvtdeealkafhelsrtegiipalesahavayamklakemsrd
eiiivnlsgrgdkdldivlkvs

SCOPe Domain Coordinates for d5t6md_:

Click to download the PDB-style file with coordinates for d5t6md_.
(The format of our PDB-style files is described here.)

Timeline for d5t6md_:

  • d5t6md_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-22