Lineage for d5u27a1 (5u27 A:1-159)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2136820Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2136821Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2136822Family c.71.1.1: Dihydrofolate reductases [53598] (4 protein domains)
  6. 2137177Protein automated matches [190514] (11 species)
    not a true protein
  7. 2284213Species Mycobacterium tuberculosis [TaxId:1773] [327514] (2 PDB entries)
  8. 2284225Domain d5u27a1: 5u27 A:1-159 [327526]
    Other proteins in same PDB: d5u27a2
    automated match to d1df7a_
    complexed with edo, nap, p65

Details for d5u27a1

PDB Entry: 5u27 (more details), 2.05 Å

PDB Description: crystal structure of mycobacterium tuberculosis dihydrofolate reductase bound to nadp and p65 inhibitor
PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d5u27a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5u27a1 c.71.1.1 (A:1-159) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
mvgliwaqatsgvigrggdipwrlpedqahfreitmghtivmgrrtwdslpakvrplpgr
rnvvlsrqadfmasgaevvgsleealtspetwvigggqvyalalpyatrcevtevdiglp
reagdalapvldetwrgetgewrfsrsglryrlysyhrs

SCOPe Domain Coordinates for d5u27a1:

Click to download the PDB-style file with coordinates for d5u27a1.
(The format of our PDB-style files is described here.)

Timeline for d5u27a1:

  • d5u27a1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-22

View in 3D
Domains from same chain:
(mouse over for more information)
d5u27a2