Lineage for d5wrff_ (5wrf F:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114715Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2116843Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (2 families) (S)
  5. 2117293Family c.23.13.0: automated matches [191662] (1 protein)
    not a true family
  6. 2117294Protein automated matches [191250] (3 species)
    not a true protein
  7. 2117295Species Acinetobacter baumannii [TaxId:400667] [260788] (8 PDB entries)
  8. 2117341Domain d5wrff_: 5wrf F: [327525]
    automated match to d4rc9a_
    complexed with edo

Details for d5wrff_

PDB Entry: 5wrf (more details), 2.51 Å

PDB Description: crystal structure of dodecameric type ii dehydroquinate dehydratase from acinetobacter baumannii with unexplained connecting electron density between free cysteine residues of molecular pairs
PDB Compounds: (F:) 3-dehydroquinate dehydratase

SCOPe Domain Sequences for d5wrff_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wrff_ c.23.13.0 (F:) automated matches {Acinetobacter baumannii [TaxId: 400667]}
sstilvihgpnlnllgkrepevyghltldninrqliaqaeqasitldtfqsnwegaivdr
ihqaqtegvkliiinpaalthtsvalrdallgvaipfievhlsnvhareafrhhsylsdk
aigvicglgakgysfaldyaiekiq

SCOPe Domain Coordinates for d5wrff_:

Click to download the PDB-style file with coordinates for d5wrff_.
(The format of our PDB-style files is described here.)

Timeline for d5wrff_: