Lineage for d5u4na_ (5u4n A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2085156Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2086456Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2086457Protein automated matches [190115] (73 species)
    not a true protein
  7. 2284222Species Neisseria gonorrhoeae [TaxId:485] [327523] (1 PDB entry)
  8. 2284223Domain d5u4na_: 5u4n A: [327524]
    automated match to d3gaya_
    complexed with edo, po4

Details for d5u4na_

PDB Entry: 5u4n (more details), 1.6 Å

PDB Description: crystal structure of a fructose-bisphosphate aldolase from neisseria gonorrhoeae
PDB Compounds: (A:) Fructose-1

SCOPe Domain Sequences for d5u4na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5u4na_ c.1.10.0 (A:) automated matches {Neisseria gonorrhoeae [TaxId: 485]}
malvsmrqlldhaaensyglpafnvnnleqmraimeaadqvnapvivqasagarkyagap
flrhlilaaveefphipvvmhqdhgaspdvcqrsiqlgfssvmmdgslledgktpssyey
nvnatrtvvnfshacgvsvegeigvlgnletgeageedgvgaagklshdqmltsvedavr
fvkdtgvdalaiavgtshgaykftrpptgdvlridrikeihqalpnthivmhgsssvpqe
wlkvineyggnigetygvpveeivegikhgvrkvnidtdlrlastgavrrylaenpsdfd
prkylgktieamkqicldrylafgcegqagkikpvslekmasryakgeln

SCOPe Domain Coordinates for d5u4na_:

Click to download the PDB-style file with coordinates for d5u4na_.
(The format of our PDB-style files is described here.)

Timeline for d5u4na_:

  • d5u4na_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-22