SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5u4na_ (5u4n A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2085156Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2086456Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2086457Protein automated matches [190115] (73 species)
    not a true protein
  7. 2284222Species Neisseria gonorrhoeae [TaxId:485] [327523] (1 PDB entry)
  8. 2284223Domain d5u4na_: 5u4n A: [327524]
    automated match to d3gaya_
    complexed with edo, po4

Details for d5u4na_

PDB Entry: 5u4n (more details), 1.6 Å

PDB Description: crystal structure of a fructose-bisphosphate aldolase from neisseria gonorrhoeae
PDB Compounds: (A:) Fructose-1

SCOPe Domain Sequences for d5u4na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5u4na_ c.1.10.0 (A:) automated matches {Neisseria gonorrhoeae [TaxId: 485]}
malvsmrqlldhaaensyglpafnvnnleqmraimeaadqvnapvivqasagarkyagap
flrhlilaaveefphipvvmhqdhgaspdvcqrsiqlgfssvmmdgslledgktpssyey
nvnatrtvvnfshacgvsvegeigvlgnletgeageedgvgaagklshdqmltsvedavr
fvkdtgvdalaiavgtshgaykftrpptgdvlridrikeihqalpnthivmhgsssvpqe
wlkvineyggnigetygvpveeivegikhgvrkvnidtdlrlastgavrrylaenpsdfd
prkylgktieamkqicldrylafgcegqagkikpvslekmasryakgeln

SCOPe Domain Coordinates for d5u4na_:

Click to download the PDB-style file with coordinates for d5u4na_.
(The format of our PDB-style files is described here.)

Timeline for d5u4na_:

  • d5u4na_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-22