SCOPe 2.06: Domain d5u26a1: 5u26 A:1-159

Lineage for d5u26a1 (5u26 A:1-159)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)

6. Protein automated matches [190514] (11 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [327514] (2 PDB entries)

8. Domain d5u26a1: 5u26 A:1-159 [327515]
   Other proteins in same PDB: d5u26a2
   automated match to d1df7a_
   complexed with edo, mmv, nap, so4

Details for d5u26a1

PDB Entry: 5u26, 1.85 Å

PDB Description: crystal structure of mycobacterium tuberculosis dihydrofolate reductase bound to nadp and p218 inhibitor

PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d5u26a1:

Sequence; same for both SEQRES and ATOM records:

>d5u26a1 c.71.1.1 (A:1-159) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
mvgliwaqatsgvigrggdipwrlpedqahfreitmghtivmgrrtwdslpakvrplpgr
rnvvlsrqadfmasgaevvgsleealtspetwvigggqvyalalpyatrcevtevdiglp
reagdalapvldetwrgetgewrfsrsglryrlysyhrs

Timeline for d5u26a1:

• d5u26a1 is new in SCOPe 2.06-stable
  
• d5u26a1 appears in SCOPe 2.07
  
• d5u26a1 appears in the current release, SCOPe 2.08