SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5mn4a1 (5mn4 A:12-208)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2107739Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2107740Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2107741Family c.32.1.1: Tubulin, GTPase domain [52491] (4 protein domains)
  6. 2107742Protein Cell-division protein FtsZ [52492] (9 species)
  7. 2107791Species Staphylococcus aureus [TaxId:1280] [226386] (6 PDB entries)
  8. 2284204Domain d5mn4a1: 5mn4 A:12-208 [327505]
    Other proteins in same PDB: d5mn4a2
    automated match to d4dxda1
    complexed with gdp, mpd

Details for d5mn4a1

PDB Entry: 5mn4 (more details), 1.5 Å

PDB Description: s. aureus ftsz 12-316 f138a gdp open form (1fof)
PDB Compounds: (A:) cell division protein ftsz

SCOPe Domain Sequences for d5mn4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mn4a1 c.32.1.1 (A:12-208) Cell-division protein FtsZ {Staphylococcus aureus [TaxId: 1280]}
atlkvigvggggnnavnrmidhgmnnvefiaintdgqalnlskaeskiqigekltrglga
ganpeigkkaaeesreqiedaiqgadmvfvtsgmgggtgtgaapvvakiakemgaltvgv
vtrpfsaegrkrqtqaaagveamkaavdtlivipndrlldivdkstpmmeafkeadnvlr
qgvqgisdliavsgevn

SCOPe Domain Coordinates for d5mn4a1:

Click to download the PDB-style file with coordinates for d5mn4a1.
(The format of our PDB-style files is described here.)

Timeline for d5mn4a1:

  • d5mn4a1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-22

View in 3D
Domains from same chain:
(mouse over for more information)
d5mn4a2