SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5thvb_ (5thv B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2115321Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456
  4. 2115322Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) (S)
  5. 2115600Family c.42.1.2: Histone deacetylase, HDAC [52773] (4 protein domains)
    automatically mapped to Pfam PF00850
  6. 2115643Protein automated matches [190786] (1 species)
    not a true protein
  7. 2115644Species Human (Homo sapiens) [TaxId:9606] [188039] (32 PDB entries)
  8. 2284201Domain d5thvb_: 5thv B: [327502]
    automated match to d2v5wb_
    complexed with b3n, edo, k, zn

Details for d5thvb_

PDB Entry: 5thv (more details), 1.87 Å

PDB Description: crystal structure of g305a hdac8 in complex with m344
PDB Compounds: (B:) Histone deacetylase 8

SCOPe Domain Sequences for d5thvb_:

Sequence, based on SEQRES records: (download)

>d5thvb_ c.42.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vpvyiyspeyvsmcdslakipkrasmvhslieayalhkqmrivkpkvasmeematfhtda
ylqhlqkvsqegdddhpdsieyglgydcpategifdyaaaiggatitaaqclidgmckva
inwsggwhhakkdeasgfcylndavlgilrlrrkferilyvdldlhhgdgvedafsftsk
vmtvslhkfspgffpgtgdvsdvglgkgryysvnvpiqdgiqdekyyqicesvlkevyqa
fnpkavvlqlgadtiagdpmcsfnmtpvgigkclkyilqwqlatlilgggaynlantarc
wtyltgvilgktlsseipdhefftaygpdyvleitpscrpdrnephriqqilnyikgnlk
hvv

Sequence, based on observed residues (ATOM records): (download)

>d5thvb_ c.42.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vpvyiyspeyvsmcdslakipkrasmvhslieayalhkqmrivkpkvasmeematfhtda
ylqhlqkvsqeygltegifdyaaaiggatitaaqclidgmckvainwsggwhhakkdeas
gfcylndavlgilrlrrkferilyvdldlhhgdgvedafsftskvmtvslhkfspgffpg
tgdvsdvglgkgryysvnvpiqdgiqdekyyqicesvlkevyqafnpkavvlqlgadtia
gdpmcsfnmtpvgigkclkyilqwqlatlilgggaynlantarcwtyltgvilgktlsse
ipdhefftaygpdyvleitpscrpdrnephriqqilnyikgnlkhvv

SCOPe Domain Coordinates for d5thvb_:

Click to download the PDB-style file with coordinates for d5thvb_.
(The format of our PDB-style files is described here.)

Timeline for d5thvb_:

  • d5thvb_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-22