SCOP 1.67: Domain d1trw__: 1trw -

Lineage for d1trw__ (1trw -)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (14 families)

5. Family c.47.1.1: Thioltransferase [52834] (9 proteins)

6. Protein Thioredoxin [52835] (9 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52842] (18 PDB entries)

8. Domain d1trw__: 1trw - [32750]
   mutant

Details for d1trw__

PDB Entry: 1trw

PDB Description: the high-resolution three-dimensional solution structures of the oxidized and reduced states of human thioredoxin

SCOP Domain Sequences for d1trw__:

Sequence; same for both SEQRES and ATOM records:

>d1trw__ c.47.1.1 (-) Thioredoxin {Human (Homo sapiens)}
mvkqiesktafqealdaagdklvvvdfsatwcgpckmikpffhslsekysnviflevdvd
daqdvaseaevkatptfqffkkgqkvgefsgankekleatinelv

Timeline for d1trw__:

• d1trw__ first appeared (with stable ids) in SCOP 1.55
  
• d1trw__ appears in SCOP 1.65
  
• d1trw__ appears in SCOP 1.69
  
• d1trw__ appears in the current release, SCOPe 2.08, called d1trwa_