Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.42: Arginase/deacetylase [52767] (1 superfamily) 3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456 |
Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) |
Family c.42.1.2: Histone deacetylase, HDAC [52773] (4 proteins) automatically mapped to Pfam PF00850 |
Protein automated matches [190786] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188039] (33 PDB entries) |
Domain d5thtb1: 5tht B:15-377 [327497] Other proteins in same PDB: d5thta2, d5thtb2 automated match to d2v5wb_ complexed with b3n, edo, k, zn |
PDB Entry: 5tht (more details), 2.41 Å
SCOPe Domain Sequences for d5thtb1:
Sequence, based on SEQRES records: (download)
>d5thtb1 c.42.1.2 (B:15-377) automated matches {Human (Homo sapiens) [TaxId: 9606]} vpvyiyspeyvsmcdslakipkrasmvhslieayalhkqmrivkpkvasmeematfhtda ylqhlqkvsqegdddhpdsieyglgydcpategifdyaaaiggatitaaqclidgmckva inwsggwhhakkdeasgfcylndavlgilrlrrkferilyvdldlhhgdgvedafsftsk vmtvslhkfspgffpgtgdvsdvglgkgryysvnvpiqdgiqdekyyqicesvlkevyqa fnpkavvlqlgadtiagdpmcsfnmtpvgigkclkyilqwqlatlilgaggynlantarc wtyltgvilgktlsseipdhefftaygpdyvleitpscrpdrnephriqqilnyikgnlk hvv
>d5thtb1 c.42.1.2 (B:15-377) automated matches {Human (Homo sapiens) [TaxId: 9606]} vpvyiyspeyvsmcdslakipkrasmvhslieayalhkqmrivkpkvasmeematfhtda ylqhlqkvsqdhpdsieyglgydcpategifdyaaaiggatitaaqclidgmckvainws ggwhhakkdeasgfcylndavlgilrlrrkferilyvdldlhhgdgvedafsftskvmtv slhkfspgffpgtgdvsdvglgkgryysvnvpiqdgiqdekyyqicesvlkevyqafnpk avvlqlgadtiagdpmcsfnmtpvgigkclkyilqwqlatlilgaggynlantarcwtyl tgvilgktlsseipdhefftaygpdyvleitpscrpdrnephriqqilnyikgnlkhvv
Timeline for d5thtb1:
View in 3D Domains from other chains: (mouse over for more information) d5thta1, d5thta2, d5thtc_, d5thtd_ |