Lineage for d5thtb1 (5tht B:15-377)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2115321Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456
  4. 2115322Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) (S)
  5. 2115600Family c.42.1.2: Histone deacetylase, HDAC [52773] (4 protein domains)
    automatically mapped to Pfam PF00850
  6. 2115643Protein automated matches [190786] (1 species)
    not a true protein
  7. 2115644Species Human (Homo sapiens) [TaxId:9606] [188039] (33 PDB entries)
  8. 2284196Domain d5thtb1: 5tht B:15-377 [327497]
    Other proteins in same PDB: d5thta2, d5thtb2
    automated match to d2v5wb_
    complexed with b3n, edo, k, zn

Details for d5thtb1

PDB Entry: 5tht (more details), 2.41 Å

PDB Description: crystal structure of g303a hdac8 in complex with m344
PDB Compounds: (B:) Histone deacetylase 8

SCOPe Domain Sequences for d5thtb1:

Sequence, based on SEQRES records: (download)

>d5thtb1 c.42.1.2 (B:15-377) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vpvyiyspeyvsmcdslakipkrasmvhslieayalhkqmrivkpkvasmeematfhtda
ylqhlqkvsqegdddhpdsieyglgydcpategifdyaaaiggatitaaqclidgmckva
inwsggwhhakkdeasgfcylndavlgilrlrrkferilyvdldlhhgdgvedafsftsk
vmtvslhkfspgffpgtgdvsdvglgkgryysvnvpiqdgiqdekyyqicesvlkevyqa
fnpkavvlqlgadtiagdpmcsfnmtpvgigkclkyilqwqlatlilgaggynlantarc
wtyltgvilgktlsseipdhefftaygpdyvleitpscrpdrnephriqqilnyikgnlk
hvv

Sequence, based on observed residues (ATOM records): (download)

>d5thtb1 c.42.1.2 (B:15-377) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vpvyiyspeyvsmcdslakipkrasmvhslieayalhkqmrivkpkvasmeematfhtda
ylqhlqkvsqdhpdsieyglgydcpategifdyaaaiggatitaaqclidgmckvainws
ggwhhakkdeasgfcylndavlgilrlrrkferilyvdldlhhgdgvedafsftskvmtv
slhkfspgffpgtgdvsdvglgkgryysvnvpiqdgiqdekyyqicesvlkevyqafnpk
avvlqlgadtiagdpmcsfnmtpvgigkclkyilqwqlatlilgaggynlantarcwtyl
tgvilgktlsseipdhefftaygpdyvleitpscrpdrnephriqqilnyikgnlkhvv

SCOPe Domain Coordinates for d5thtb1:

Click to download the PDB-style file with coordinates for d5thtb1.
(The format of our PDB-style files is described here.)

Timeline for d5thtb1:

  • d5thtb1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-22