Lineage for d5mn5b1 (5mn5 B:13-202)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2107739Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2107740Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2107741Family c.32.1.1: Tubulin, GTPase domain [52491] (4 protein domains)
  6. 2107742Protein Cell-division protein FtsZ [52492] (9 species)
  7. 2107791Species Staphylococcus aureus [TaxId:1280] [226386] (6 PDB entries)
  8. 2284192Domain d5mn5b1: 5mn5 B:13-202 [327493]
    Other proteins in same PDB: d5mn5a2, d5mn5b2
    automated match to d4dxda1
    complexed with gtp

Details for d5mn5b1

PDB Entry: 5mn5 (more details), 2.8 Å

PDB Description: s. aureus ftsz 12-316 t66w gtp closed form (2tcm)
PDB Compounds: (B:) cell division protein ftsz

SCOPe Domain Sequences for d5mn5b1:

Sequence, based on SEQRES records: (download)

>d5mn5b1 c.32.1.1 (B:13-202) Cell-division protein FtsZ {Staphylococcus aureus [TaxId: 1280]}
tlkvigvggggnnavnrmidhgmnnvefiaintdgqalnlskaeskiqigeklwrglgag
anpeigkkaaeesreqiedaiqgadmvfvtsgmgggtgtgaapvvakiakemgaltvgvv
trpfsfegrkrqtqaaagveamkaavdtlivipndrlldivdkstpmmeafkeadnvlrq
gvqgisdlia

Sequence, based on observed residues (ATOM records): (download)

>d5mn5b1 c.32.1.1 (B:13-202) Cell-division protein FtsZ {Staphylococcus aureus [TaxId: 1280]}
tlkvigvggggnnavnrmidhgmnnvefiaintdgqalnlskaeskiqignpeigkkaae
esreqiedaiqgadmvfvtsgmgggtgtgaapvvakiakemgaltvgvvtrpfsfegrkr
qtqaaagveamkaavdtlivipndrlldivdkstpmmeafkeadnvlrqgvqgisdlia

SCOPe Domain Coordinates for d5mn5b1:

Click to download the PDB-style file with coordinates for d5mn5b1.
(The format of our PDB-style files is described here.)

Timeline for d5mn5b1:

  • d5mn5b1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-22

View in 3D
Domains from same chain:
(mouse over for more information)
d5mn5b2