Lineage for d5ltpc1 (5ltp C:0-219)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2164731Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2164732Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2165335Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 2165336Protein automated matches [190526] (21 species)
    not a true protein
  7. 2165337Species Amphioxus (Branchiostoma lanceolatum) [TaxId:7740] [227942] (7 PDB entries)
  8. 2284184Domain d5ltpc1: 5ltp C:0-219 [327485]
    Other proteins in same PDB: d5ltpb2, d5ltpc2, d5ltpd2, d5ltpe2, d5ltpf2
    automated match to d3neda_
    complexed with cl, flc

Details for d5ltpc1

PDB Entry: 5ltp (more details), 1.7 Å

PDB Description: structure of the yellow-green fluorescent protein mneongreen from branchiostoma lanceolatum at the acidic ph 4.5
PDB Compounds: (C:) mNeonGreen

SCOPe Domain Sequences for d5ltpc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ltpc1 d.22.1.0 (C:0-219) automated matches {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]}
maslpathelhifgsingvdfdmvgqgtgnpndgyeelnlkstkgdlqfspwilvphigy
gfhqylpypdgmspfqaamvdgsgyqvhrtmqfedgasltvnyrytyegshikgeaqvkg
tgfpadgpvmtnsltaadwcrskktypndktiistfkwsyttgngkryrstarttytfak
pmaanylknqpmyvfrktelkhsktelnfkewqkaftdvm

SCOPe Domain Coordinates for d5ltpc1:

Click to download the PDB-style file with coordinates for d5ltpc1.
(The format of our PDB-style files is described here.)

Timeline for d5ltpc1:

  • d5ltpc1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-22