SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5t6mc1 (5t6m C:1-388)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2139769Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2139770Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2139771Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 protein domains)
  6. 2140010Protein automated matches [190054] (13 species)
    not a true protein
  7. 2284179Species Pyrococcus furiosus [TaxId:2261] [327480] (1 PDB entry)
  8. 2284182Domain d5t6mc1: 5t6m C:1-388 [327483]
    Other proteins in same PDB: d5t6mc2
    automated match to d1v8zb_
    complexed with 78u, na, po4

Details for d5t6mc1

PDB Entry: 5t6m (more details), 1.8 Å

PDB Description: structure of the tryptophan synthase b-subunit from pyroccus furiosus with b-methyltryptophan non-covalently bound
PDB Compounds: (C:) Tryptophan synthase beta chain 1

SCOPe Domain Sequences for d5t6mc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t6mc1 c.79.1.1 (C:1-388) automated matches {Pyrococcus furiosus [TaxId: 2261]}
mwfgefggqyvpetlieplkelekaykrfkddeefnrqlnyylktwagrptplyyakrlt
ekiggakiylkredlvhggahktnnaigqallakfmgktrliaetgagqhgvatamagal
lgmkvdiymgaedverqkmnvfrmkllganvipvnsgsrtlkdainealrdwvatfeyth
yligsvvgphpyptivrdfqsvigreakaqileaegqlpdvivacvgggsnamgifypfv
ndkkvklvgveaggkglesgkhsaslnagqvgvfhgmlsyflqdeegqikpthsiapgld
ypgvgpehaylkkiqraeyvtvtdeealkafhelsrtegiipalesahavayamklakem
srdeiiivnlsgrgdkdldivlkvsgnv

SCOPe Domain Coordinates for d5t6mc1:

Click to download the PDB-style file with coordinates for d5t6mc1.
(The format of our PDB-style files is described here.)

Timeline for d5t6mc1:

  • d5t6mc1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-22