Lineage for d5mmzb_ (5mmz B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2116263Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 2116264Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 2116265Family c.45.1.1: Dual specificity phosphatase-like [52800] (9 protein domains)
  6. 2116321Protein automated matches [190696] (3 species)
    not a true protein
  7. 2277914Species Mus musculus [TaxId:10090] [321215] (3 PDB entries)
  8. 2284178Domain d5mmzb_: 5mmz B: [327479]
    automated match to d2mbca_

Details for d5mmzb_

PDB Entry: 5mmz (more details), 2.4 Å

PDB Description: structure of prl-1 in complex with the bateman domain of cnnm2
PDB Compounds: (B:) Protein tyrosine phosphatase type IVA 1

SCOPe Domain Sequences for d5mmzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mmzb_ c.45.1.1 (B:) automated matches {Mus musculus [TaxId: 10090]}
apvevtyknmrflithnptnatlnkfieelkkygvttivrvceatydttlvekegihvld
wpfddgappsnqivddwlslvkikfreepgcciavhcvaglgrapvlvalalieggmkye
davqfirqkrrgafnskqllylekyrpkmr

SCOPe Domain Coordinates for d5mmzb_:

Click to download the PDB-style file with coordinates for d5mmzb_.
(The format of our PDB-style files is described here.)

Timeline for d5mmzb_:

  • d5mmzb_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-22