SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5mmzb_ (5mmz B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2116263Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 2116264Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 2116265Family c.45.1.1: Dual specificity phosphatase-like [52800] (9 protein domains)
  6. 2116321Protein automated matches [190696] (3 species)
    not a true protein
  7. 2277914Species Mus musculus [TaxId:10090] [321215] (3 PDB entries)
  8. 2284178Domain d5mmzb_: 5mmz B: [327479]
    automated match to d2mbca_

Details for d5mmzb_

PDB Entry: 5mmz (more details), 2.4 Å

PDB Description: structure of prl-1 in complex with the bateman domain of cnnm2
PDB Compounds: (B:) Protein tyrosine phosphatase type IVA 1

SCOPe Domain Sequences for d5mmzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mmzb_ c.45.1.1 (B:) automated matches {Mus musculus [TaxId: 10090]}
apvevtyknmrflithnptnatlnkfieelkkygvttivrvceatydttlvekegihvld
wpfddgappsnqivddwlslvkikfreepgcciavhcvaglgrapvlvalalieggmkye
davqfirqkrrgafnskqllylekyrpkmr

SCOPe Domain Coordinates for d5mmzb_:

Click to download the PDB-style file with coordinates for d5mmzb_.
(The format of our PDB-style files is described here.)

Timeline for d5mmzb_:

  • d5mmzb_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-22